PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PM65M
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 404aa    MW: 44351.8 Da    PI: 8.7107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PM65MgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32246299255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Araip.PM65M 246 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 299
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15243299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28244299IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-24246299IPR006447Myb domain, plants
PfamPF002497.1E-7247298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MPLEGIFMEA SSSTTPTPDL SLQISPPTIS SSSSSLICKG SSSSSSNNHN NNNNNNFPEL  60
SLGSNFINYS NSSSNNNNSY YRAISGAHHH INYGGVSLLD ASDGGGVLRR PIKGIPVYHN  120
RSFPFMATSS SPSTMEYSRE NNKVNMCSYH HHQYMIPSSS PSSISLPNNN SNYFIGPAPS  180
SSSSSSPALD PITRLSAFKS HHHPLHHHHH EVAASHHHHH HHHAGFMMRS SRFLPKLPTK  240
RSMRAPRMRW TSTLHARFVH AVELLGGHER ATPKSVLELM DVKDLTLAHV KSHLQMYRTV  300
KTTDKPAASS DGSGDDDMSP VGGSGDCSGS LRQFSDQRGR PDRSLLQQDM DYSSTTTTTL  360
WSNSSSCRET WQQTTSDING LRQPILHSQT KSGGQNSHIQ ECDS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016167307.10.0PREDICTED: transcription repressor KAN1-like
TrEMBLG7J8N81e-112G7J8N8_MEDTR; Transcription factor KAN2
STRINGGLYMA14G39260.21e-106(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-47G2-like family protein